PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629762.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 742aa    MW: 81727.5 Da    PI: 5.0706
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629762.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.92.2e-2081137157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     r++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  XP_009629762.1  81 RKRYHRHTQHQIQEMENFFKNCPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 137
                     789999************************************************995 PP

2START187.56.9e-592664861206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++e++++a+ +ep+W  s       +n++e+++ f+ + +     +++ea+++++vv+m++ +lve+l+d + +W+ ++      a t+
  XP_009629762.1 266 ELAVAAMEEFIQMAQMGEPLWLPSIdrrtNFLNEEEYVRLFPLGIGpklegFKTEASKDTAVVFMNHIKLVEILMDAN-KWSSMFSsivsTAVTV 359
                     57899********************999999**********99999********************************.*******999999*** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +v+s+g      galq+++ae+q++ p vp Rd +fvRy++++ +g w++vdvS+d  +  p+    +R++++pSg+li++++ng+skvtw+ehv
  XP_009629762.1 360 DVLSTGvagnfnGALQVIFAEFQVPFPQVPtRDCYFVRYCKRSVDGIWAVVDVSLDYLRATPT----ARCRRRPSGCLIQEMPNGYSKVTWIEHV 450
                     ************************************************************996....**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     + ++  + +++++l++sgla+gak+w atl+rqce+
  XP_009629762.1 451 EADDTAIYSIYKPLLNSGLAFGAKRWIATLDRQCER 486
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2160136IPR009057Homeodomain-like
SuperFamilySSF466891.59E-1970139IPR009057Homeodomain-like
PROSITE profilePS5007117.34678138IPR001356Homeobox domain
SMARTSM003894.8E-1979142IPR001356Homeobox domain
CDDcd000868.76E-2080139No hitNo description
PfamPF000465.9E-1881136IPR001356Homeobox domain
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
SuperFamilySSF559615.16E-35257488No hitNo description
PROSITE profilePS5084842.466257489IPR002913START domain
CDDcd088751.41E-119261485No hitNo description
SMARTSM002342.6E-53266486IPR002913START domain
PfamPF018521.2E-47267486IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-7334486IPR023393START-like domain
SuperFamilySSF559613.41E-23517733No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MIPANQFSSM IGNDENDVGF VSSSSGLPLG QSGNIMDMAS NTSESELMPL LTEEEFDSKS  60
GSDNQEGKSS DEQDANQSER RKRYHRHTQH QIQEMENFFK NCPHPDDKQR KELSRELGLE  120
PLQVKFWFQN KRTQMKNQNE RSELSSLRDE NEKLRTEHVQ IREALNNATS CPSCPICGGP  180
QISLGEMSFE ENQLRIENAR LKEEVDRISA FAAKHLGKPV SSLNVYSSPV TPPSSLDLGN  240
AFGNNGEVLR SSFNGPTEAE KPFIIELAVA AMEEFIQMAQ MGEPLWLPSI DRRTNFLNEE  300
EYVRLFPLGI GPKLEGFKTE ASKDTAVVFM NHIKLVEILM DANKWSSMFS SIVSTAVTVD  360
VLSTGVAGNF NGALQVIFAE FQVPFPQVPT RDCYFVRYCK RSVDGIWAVV DVSLDYLRAT  420
PTARCRRRPS GCLIQEMPNG YSKVTWIEHV EADDTAIYSI YKPLLNSGLA FGAKRWIATL  480
DRQCERLASA MATNLPDDNT TNMILGGPEG RRSVLKLAER MVISYCSGVS ATAAHQWTTL  540
SGSGSENDVR IMFRKSINDP GRPPGIVMCA ATSFWLPISP KTAFDFLRDE NTRSEWDILS  600
NGGVIQRLVH IANGRETGNS VSILRVNSSA NLRQNNMLIL QESSTDPTGS FVVYAPVDVP  660
AMNTVINGGD PDYVALLPSG FAILPDGPPG RIAGGSLLTI AFQILVDSVP TAKLSLGSVA  720
TVNKLIACTV DKIRAALLSD TP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629762.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X2
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2